A Helping Hand for Your Research

Phone: 610-945-2007
Fax:

EN CH

G Proteins and Oncogene

PRODUCT CENTER

Rab35 Protein Q67L mutant

Price$248.00
BrandNewEastBio   
Place of OriginUSA
Catalog Number10133
ImmunogenE. coli
Size25 μl
Technical InformationView technical data
  • Data Sheet
  • Reference
Purchase by sweeping
  • Summary

    Rab35 Protein Q67L mutant [10133]
    [25 µg]


    Catalog Number:  10133
    Product Name:  Rab35 Protein Q67L mutant
    Synonyms:  Member RAS oncogene family, RAY, H-ray, RAB1C
    Source:   Human, recombinant full length, His6-tag
    Expression Host:   E. coli
    Molecular Weight:   23 kDa
    Purity:   >95% by SDS-PAGE
    Introduction:   The Ras super-family of small GTP-binding proteins, which includes the Ras, Ral, Rho, Rap, and Rab families, the Rab family appears to play a critical role in regulating exocytotic and endocytotic pathways. RAB35 regulates the assembly of actin filaments during bristle development in Drosophila and filopodia formation in cultured cells.
    Amino Acid Sequence   (1-201, Q67L)
    MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGL 
    ERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETED 
    AYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC
    Properties
    Physical Appearance (form):   Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.
    Physical Appearance (form):  White or clear
    Concentration: 1 mg/mL
    Storage:   -80°C
    Preparation Instructions:  
    Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rab35 QL was determined by SDS-PAGE and Coomassie Brilliant Blue Staining.
    References:  
    1. Zhang, J. et al., Science 325: 1250-1254, 2009. 
    2. Zhu, A. X. et al., Biochem. Biophys. Res. Commun. 205: 1875-1882, 1994.
    Datasheet:  


    Related Products
    Catalog#NameSizePrice
    82801Rab35 Activation Assay Kit 20 assays $737   
    26922Active Rab35-GTP Monoclonal Antibody 30 μL $495   
    26033Anti Rab35 Mouse Monoclonal Antibody 100 μL $239
    21078Anti-Rab35 Rabbit Polyclonal Antibody 100 μL $219
    10133Rab35 Protein Q67L mutant 25 μL $248



      no data