A Helping Hand for Your Research

Phone: 610-945-2007
Fax:

EN CH

G Proteins and Oncogene

PRODUCT CENTER

Arf6 Protein

Price$239.00
BrandNewEastBio   
Place of OriginUSA
Catalog Number10124
ImmunogenE. coli
Size100 μl
Technical InformationView technical data
  • Data Sheet
  • Reference
Purchase by sweeping
  • Summary

    Arf6 Protein [10124]
    [100 µg]


    Catalog Number:  10124
    Product Name:  Arf6 Protein
    Synonyms:  ADP-ribosylation factor 6
    Source:   Human recombinant, His6-tag
    Expression Host:   E. coli
    Molecular Weight:   17 kDa
    Purity:   >95% by SDS-PAGE
    Introduction:   Arf6 is a member of the ARF super-family. ARF genes encode small GTPases that increase the ADP-ribosyltransferase activity of cholera toxin and are critical for vesicular trafficking as activators of phospholipase D. Arf6 regulates membrane trafficking and the actin cytoskeketon at the plasma membrane and functions as a regulatory molecule of phagocytosis.
    Amino Acid Sequence   (13-175)
    EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYT 
    GTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRD 
    RNWYVQPSCATSGDGLYEGLTWLTSNYKS
    Properties
    Physical Appearance (form):   Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.
    Physical Appearance (form):  White or clear
    Concentration:  1 mg/mL
    Storage:   -80°C
    Preparation Instructions:  
    Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Arf6 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.
    References:  
    1. Cavenagh, M. M. et al., J. Biol. Chem. 271: 21767-21774, 1996. 
    2. D'Souza-Schorey, C. et al., Science 267: 1175-1178, 1995. 
    3. Falace, A. et al., Am. J. Hum. Genet. 87: 365-370, 2010. 
    4. Hernandez-Deviez, D. J. et al., Nature Neurosci. 5: 623-624, 2002. 
    5. O'Neal, C. J. et al., Science 309: 1093-1096, 2005.
    Datasheet:  

    Related Products
    Catalog#NameSizePrice
    82401Arf6 Activation Assay Kit 20 assays $737  
    26918Active Arf6-GTP Monoclonal Antibody 30 μL $495   
    26029Anti-Arf6 Mouse Monoclonal Antibody 100 μL $239   
    26019Anti-Arf6 Mouse Monoclonal Antibody 100 μL $239   
    21032Anti-Arf6 Rabbit Polyclonal Antibody 100 μL $219   
    21030Anti-Arf1 Rabbit Polyclonal Antibody 100 μL $219   
    10124Arf6 Protein 100 μL $239   
    10156Arl1 Protein Q71L mutant 100 μL $239   



      no data